Paralogue Annotation for RYR2 residue 2888

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2888
Reference Amino Acid: K - Lysine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2888

No paralogue variants have been mapped to residue 2888 for RYR2.



RYR2MELESKGGGNHPLLVPYDTLTAKEKAKDRE>K<AQDILKFLQINGYAVSRGFKDLELDTPSIE2918
RYR1QELEAKGGGTHPLLVPYDTLTAKEKARDRE>K<AQELLKFLQMNGYAVTRGLKDMELDSSSIE2952
RYR3LELESKGGGSHPLLVPYDTLTAKEKFKDRE>K<AQDLFKFLQVNGIIVSRGMKDMELDASSME2813
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K2888Qc.8662A>C Putative BenignSIFT: deleterious
Polyphen: probably damaging