Paralogue Annotation for RYR2 residue 2939

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2939
Reference Amino Acid: Y - Tyrosine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2939

No paralogue variants have been mapped to residue 2939 for RYR2.



RYR2DLELDTPSIEKRFAYSFLQQLIRYVDEAHQ>Y<ILEFDGG-SRGKGEHFPYEQEIKFFAKVVL2968
RYR1DMELDSSSIEKRFAFGFLQQLLRWMDISQE>F<IAHLEAVVSSGRVEKSPHEQEIKFFAKILL3003
RYR3DMELDASSMEKRFAYKFLKKILKYVDSAQE>F<IAHLEAIVSSGKTEKSPRDQEIKFFAKVLL2864
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y2939Cc.8816A>G Putative BenignSIFT: tolerated
Polyphen: possibly damaging