Paralogue Annotation for RYR2 residue 2962

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2962
Reference Amino Acid: F - Phenylalanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2962

No paralogue variants have been mapped to residue 2962 for RYR2.



RYR2VDEAHQYILEFDGG-SRGKGEHFPYEQEIK>F<FAKVVLPLIDQYFKNHRLYFLSAASRPLCS2992
RYR1MDISQEFIAHLEAVVSSGRVEKSPHEQEIK>F<FAKILLPLINQYFTNHCLYFLSTPAKVLGS3027
RYR3VDSAQEFIAHLEAIVSSGKTEKSPRDQEIK>F<FAKVLLPLVDQYFTSHCLYFLSSPLKPLSS2888
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F2962Lc.8886C>A Putative BenignSIFT: deleterious
Polyphen: possibly damaging