Paralogue Annotation for RYR2 residue 3061

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3061
Reference Amino Acid: L - Leucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3061

No paralogue variants have been mapped to residue 3061 for RYR2.



RYR2NCLHILGQTLDARTVMKTGLESVKSALRAF>L<DNAAEDLEKTMENLKQGQFTHTRNQPKGVT3091
RYR1NCLHILARSLDARTVMKSGPEIVKAGLRSF>F<ESASEDIEKMVENLRLGKVSQARTQVKGVG3126
RYR3SCLHILAQTLDTRTVMKSGSELVKAGLRAF>F<ENAAEDLEKTSENLKLGKFTHSRTQIKGVS2987
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L3061Vc.9181C>G Putative BenignSIFT: deleterious
Polyphen: benign