Paralogue Annotation for RYR2 residue 3258

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3258
Reference Amino Acid: P - Proline
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3258

No paralogue variants have been mapped to residue 3258 for RYR2.



RYR2YTQMPHVMEVILPMLCSYMSRWWEHGPENN>P<E----RAEMCCTALNSEHMNTLLGNILKII3284
RYR1YTEMPHVIEITLPMLCSYLPRWWERGPEAP>P<SALPAGAPPPCTAVTSDHLNSLLGNILRII3323
RYR3YTEMPHVIEVILPMLCNYLSYWWERGPENL>P<P----STGPCCTKVTSEHLSLILGNILKII3180
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P3258Sc.9772C>T Putative BenignSIFT: tolerated
Polyphen: benign