Paralogue Annotation for RYR2 residue 3309

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3309
Reference Amino Acid: K - Lysine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3309

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1R3348HMalignant hyperthermiaMedium8 15731587, 25735680
RYR1R3348GMalignant hyperthermiaMedium8 22415532, 22415532

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2NILKIIYNNLGIDEGAWMKRLAVFSQPIIN>K<VKPQLLKTHFLPLMEKLKKKAATVVSEEDH3339
RYR1NILRIIVNNLGIDEASWMKRLAVFAQPIVS>R<ARPELLQSHFIPTIGRLRKRAGKVVSEEEQ3378
RYR3NILKIINNNLGIDEASWMKRIAVYAQPIIS>K<ARPDLLRSHFIPTLEKLKKKAVKTVQEEEQ3235
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 3309 for RYR2.