Paralogue Annotation for RYR2 residue 3382

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3382
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3382

No paralogue variants have been mapped to residue 3382 for RYR2.



RYR2ELLILDEFTTLARDLYAFYPLLIRFVDYNR>A<KWLKEPNPEAEELFRMVAEVFIYWSKSHNF3412
RYR1ELLVRDEFSVLCRDLYALYPLLIRYVDNNR>A<QWLTEPNPSAEELFRMVGEIFIYWSKSHNF3451
RYR3ELLILDEFAVLCRDLYAFYPMLIRYVDNNR>S<NWLKSPDADSDQLFRMVAEVFILWCKSHNF3308
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A3382Tc.10144G>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging