Paralogue Annotation for RYR2 residue 342

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 342
Reference Amino Acid: V - Valine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 342

No paralogue variants have been mapped to residue 342 for RYR2.



RYR2LLMDKEKADVKSTAFTFRS---SKEKLDVG>V<RKEVDGMGTSEIKYGDSVCYIQHVDTGLWL372
RYR1VVVDASKAHTKATSFCFRI---SKEKLDVA>P<KRDVEGMGPPEIKYGESLCFVQHVASGLWL356
RYR3ILQDRAKSDTKSTAFSFRASKELKEKLDSS>H<KRDIEGMGVPEIKYGDSVCFVQHIASGLWV364
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V342Mc.1024G>A Putative BenignSIFT: tolerated
Polyphen: benign