Paralogue Annotation for RYR2 residue 3466

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3466
Reference Amino Acid: I - Isoleucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3466

No paralogue variants have been mapped to residue 3466 for RYR2.



RYR2KAA-----VSDQERKKMKRKGDRYSMQTSL>I<VAALKRLLPIGLNICAPGDQELIALAKNRF3496
RYR1KAGDIQSGGSDQERTKKKRRGDRYSVQTSL>I<VATLKKMLPIGLNMCAPTDQDLITLAKTRY3540
RYR3KAMQVKSGGQDQERKKTKRRGDLYSIQTSL>I<VAALKKMLPIGLNMCTPGDQELISLAKSRY3397
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I3466Mc.10398T>G Putative BenignSIFT: tolerated
Polyphen: possibly damaging