Paralogue Annotation for RYR2 residue 3530

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3530
Reference Amino Acid: L - Leucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3530

No paralogue variants have been mapped to residue 3530 for RYR2.



RYR2TEDEVRDIIRSNIHLQGKLE-DPAIRWQMA>L<YKDLPNRTDDTSDPEKTVERVLDIANVLFH3560
RYR1TDEEVREFLHNNLHLQGKVEGSPSLRWQMA>L<YRGVPGREEDADDPEKIVRRV---------3596
RYR3TDEEVREHLRNNLHLQEKSD-DPAVKWQLN>L<YKDVLK-SEEPFNPEKTVERV---------3451
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L3530Ic.10588C>A Putative BenignSIFT: deleterious
Polyphen: benign