Paralogue Annotation for RYR2 residue 3538

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3538
Reference Amino Acid: T - Threonine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3538

No paralogue variants have been mapped to residue 3538 for RYR2.



RYR2IRSNIHLQGKLE-DPAIRWQMALYKDLPNR>T<DDTSDPEKTVERVLDIANVLFHLEQKSKRV3568
RYR1LHNNLHLQGKVEGSPSLRWQMALYRGVPGR>E<EDADDPEKIVRRV-------------QEVS3600
RYR3LRNNLHLQEKSD-DPAVKWQLNLYKDVLK->S<EEPFNPEKTVERV-------------QRIS3455
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 3538 for RYR2.