Paralogue Annotation for RYR2 residue 355

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 355
Reference Amino Acid: K - Lysine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 355

No paralogue variants have been mapped to residue 355 for RYR2.



RYR2AFTFRS---SKEKLDVGVRKEVDGMGTSEI>K<YGDSVCYIQHVDTGLWLTYQSVDVKSVRMG385
RYR1SFCFRI---SKEKLDVAPKRDVEGMGPPEI>K<YGESLCFVQHVASGLWLTYAAPDPKALRLG369
RYR3AFSFRASKELKEKLDSSHKRDIEGMGVPEI>K<YGDSVCFVQHIASGLWVTYKAQDAKTSRLG377
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K355Ec.1063A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging