Paralogue Annotation for RYR2 residue 3581

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3581
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3581

No paralogue variants have been mapped to residue 3581 for RYR2.



RYR2LDIANVLFHLEQKSKRVGRRHYCL-VEHPQ>R<SKKAVWHKLLSKQRKRAVVACFRMAPLYNL3611
RYR1-------------QEVSAVLYYLDQTEHPY>K<SKKAVWHKLLSKQRRRAVVACFRMTPLYNL3644
RYR3-------------QRISAAVFHLEQVEQPL>R<SKKAVWHKLLSKQRKRAVVACFRMAPLYNL3499
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R3581Kc.10742G>A Other Cardiac PhenotypeSIFT:
Polyphen:
ReportsOther Cardiac Phenotype Genetic investigations of sudden unexpected deaths in infancy using next-generation sequencing of 100 genes associated with cardiac diseases. Eur J Hum Genet. 2016 24(6):817-22. doi: 10.1038/ejhg.2015.198. 26350513