Paralogue Annotation for RYR2 residue 3604

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3604
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3604

No paralogue variants have been mapped to residue 3604 for RYR2.



RYR2L-VEHPQRSKKAVWHKLLSKQRKRAVVACF>R<MAPLYNLPRHRAVNLFLQGYEKSWIETEEH3634
RYR1DQTEHPYKSKKAVWHKLLSKQRRRAVVACF>R<MTPLYNLPTHRACNMFLESYKAAWILTEDH3667
RYR3EQVEQPLRSKKAVWHKLLSKQRKRAVVACF>R<MAPLYNLPRHRSINLFLHGYQRFWIETEEY3522
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R3604Lc.10811G>T Putative BenignSIFT: deleterious
Polyphen: probably damaging