Paralogue Annotation for RYR2 residue 3669

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3669
Reference Amino Acid: L - Leucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3669

No paralogue variants have been mapped to residue 3669 for RYR2.



RYR2LIEDLAKPG-AEPPEEDEGTKRVDPLHQLI>L<LFSRTALTEKCKLEEDFLYMAYADIMAKSC3699
RYR1MIDDLSKAGEQEEEEEEVEEKKPDPLHQLV>L<HFSRTALTEKSKLDEDYLYMAYADIMAKSC3733
RYR3LVQDLAKSPKVEEEEEEETEKQPDPLHQII>L<YFSRNALTERSKLEDDPLYTSYSSMMAKSC3588
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L3669Fc.11005C>T Putative BenignSIFT: tolerated
Polyphen: probably damaging