Paralogue Annotation for RYR2 residue 3701

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3701
Reference Amino Acid: D - Aspartate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3701

No paralogue variants have been mapped to residue 3701 for RYR2.



RYR2FSRTALTEKCKLEEDFLYMAYADIMAKSCH>D<EED-D--DGEEE-VKSFEEKEMEKQKLLYQ3727
RYR1FSRTALTEKSKLDEDYLYMAYADIMAKSCH>L<EEGGENGEAEEEVEVSFEEKQMEKQRLLYQ3765
RYR3FSRNALTERSKLEDDPLYTSYSSMMAKSCQ>S<GED-E--EEDEDKEKTFEEKEMEKQKTLYQ3617
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D3701Ec.11103T>A Putative BenignSIFT: tolerated
Polyphen: benign