Paralogue Annotation for RYR2 residue 3800

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3800
Reference Amino Acid: C - Cysteine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3800

No paralogue variants have been mapped to residue 3800 for RYR2.



RYR2NSTVQQKMLDYLKEKKDVGFFQSLAGLMQS>C<SVLDLNAFERQNKAEGLGMVTEEGS-----3825
RYR1NAEVQQKMLDYLKDKKEVGFFQSIQALMQT>C<SVLDLNAFERQNKAEGLGMVNEDGTVINRQ3868
RYR3NAGVQQKMLDYLKEKKDAGFFQSLSGLMQS>C<SVLDLNAFERQNKAEGLGMVTEEGTLIVRE3720
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.C3800Fc.11399G>T Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaCPVT Spectrum and prevalence of cardiac ryanodine receptor (RyR2) mutations in a cohort of unrelated patients referred explicitly for long QT syndrome genetic testing. Heart Rhythm. 2005 2(10):1099-105. 16188589
Inherited ArrhythmiaCPVT The RYR2-encoded ryanodine receptor/calcium release channel in patients diagnosed previously with either catecholaminergic polymorphic ventricular tachycardia or genotype negative, exercise-induced long QT syndrome: a comprehensive open reading frame mutational analysis. J Am Coll Cardiol. 2009 54(22):2065-74. 19926015
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
p.C3800Sc.11398T>A Putative BenignSIFT: deleterious
Polyphen: benign