Paralogue Annotation for RYR2 residue 391

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 391
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 391

No paralogue variants have been mapped to residue 391 for RYR2.



RYR2CYIQHVDTGLWLTYQSVDVKSVRMGSIQRK>A<IMHHEGHMDDGISLSRSQHEESRTARVIRS421
RYR1CFVQHVASGLWLTYAAPDPKALRLGVLKKK>A<MLHQEGHMDDALSLTRCQQEESQAARMIHS405
RYR3CFVQHIASGLWVTYKAQDAKTSRLGPLKRK>V<ILHQEGHMDDGLTLQRCQREESQAARIIRN413
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A391Gc.1172C>G Putative BenignSIFT: deleterious
Polyphen: benign