Paralogue Annotation for RYR2 residue 3941

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3941
Reference Amino Acid: W - Tryptophan
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3941

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1W3985RMalignant hyperthermia ?High9 18719443, 23558838

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2QVAKQVFNTLTEYIQGPCTGNQQSLAHSRL>W<DAVVGFLHVFAHMQMKLSQDSSQIELLKEL3971
RYR1SVAKQVFNSLTEYIQGPCTGNQQSLAHSRL>W<DAVVGFLHVFAHMMMKLAQDSSQIELLKEL4015
RYR3AVTKQIFNSLTEYIQGPCIGNQQSLAHSRL>W<DAVVGFLHVFANMQMKLSQDSSQIELLKEL3867
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 3941 for RYR2.