Paralogue Annotation for RYR2 residue 3943

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3943
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3943

No paralogue variants have been mapped to residue 3943 for RYR2.



RYR2AKQVFNTLTEYIQGPCTGNQQSLAHSRLWD>A<VVGFLHVFAHMQMKLSQDSSQIELLKELMD3973
RYR1AKQVFNSLTEYIQGPCTGNQQSLAHSRLWD>A<VVGFLHVFAHMMMKLAQDSSQIELLKELLD4017
RYR3TKQIFNSLTEYIQGPCIGNQQSLAHSRLWD>A<VVGFLHVFANMQMKLSQDSSQIELLKELLD3869
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A3943Tc.11827G>A Other Cardiac PhenotypeSIFT:
Polyphen:
ReportsOther Cardiac Phenotype Cardiac channelopathy testing in 274 ethnically diverse sudden unexplained deaths. Forensic Sci Int. 2014 237:90-9. doi: 10.1016/j.forsciint.2014.01.014. 24631775