Paralogue Annotation for RYR2 residue 40

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 40
Reference Amino Acid: E - Glutamate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 40

No paralogue variants have been mapped to residue 40 for RYR2.



RYR2EIQFLRTDDEVVLQCTATIHKEQQKLCLAA>E<GFGNRLCFLESTSNSKNVPPDLSICTFVLE70
RYR1EVQFLRTDDEVVLQCSATVLKEQLKLCLAA>E<GFGNRLCFLEPTSNAQNVPPDLAICCFVLE69
RYR3EIQFLRTEDEVVLQCIATIHKEQRKFCLAA>E<GLGNRLCFLEPTSEAKYIPPDLCVCNFVLE71
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E40Gc.119A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging