Paralogue Annotation for RYR2 residue 4083

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4083
Reference Amino Acid: F - Phenylalanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4083

No paralogue variants have been mapped to residue 4083 for RYR2.



RYR2ESHKHYTQSETEFLLSCAETDENETLDYEE>F<VKRFHEPAKDIGFNVAVLLTNLSEHMPNDT4113
RYR1DSQKQFSGPEIQFLLSCSEADENEMINCEE>F<ANRFQEPARDIGFNVAVLLTNLSEHVPHDP4157
RYR3EGQKQYTQSEIDFLLSCAEADENDMFNYVD>F<VDRFHEPAKDIGFNVAVLLTNLSEHMPNDS4009
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F4083Lc.12249C>A Putative BenignSIFT: deleterious
Polyphen: probably damaging