Paralogue Annotation for RYR2 residue 4109

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4109
Reference Amino Acid: M - Methionine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4109

No paralogue variants have been mapped to residue 4109 for RYR2.



RYR2DYEEFVKRFHEPAKDIGFNVAVLLTNLSEH>M<PNDTRLQTFLELAESVLNYFQPFLGRIEIM4139
RYR1NCEEFANRFQEPARDIGFNVAVLLTNLSEH>V<PHDPRLHNFLELAESILEYFRPYLGRIEIM4183
RYR3NYVDFVDRFHEPAKDIGFNVAVLLTNLSEH>M<PNDSRLKCLLDPAESVLNYFEPYLGRIEIM4035
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M4109Rc.12326T>G Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaCPVT Postpacing abnormal repolarization in catecholaminergic polymorphic ventricular tachycardia associated with a mutation in the cardiac ryanodine receptor gene. Heart Rhythm. 2011 8(10):1546-52. 21699856
Inherited ArrhythmiaCPVT Modeling of catecholaminergic polymorphic ventricular tachycardia with patient-specific human-induced pluripotent stem cells. J Am Coll Cardiol. 2012 60(11):990-1000. doi: 10.1016/j.jacc.2012.02.066. 22749309
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
p.Met4109Valc.12325A>G UnknownSIFT:
Polyphen: