Paralogue Annotation for RYR2 residue 4216

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4216
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4216

No paralogue variants have been mapped to residue 4216 for RYR2.



RYR2MELFVNFCEDTIFEMQLAAQISESDLNERS>A<NKEESEK-----ERPEEQGPRMAFFSILTV4241
RYR1MELFVSFCEDTIFEMQIAAQISEPEGEPET>D<EDEGAGAAEAGAEGAEEGAAGLEGTAATAA4290
RYR3MELFVNFCEDTIFEMQLASQISESDSADRP>E<EEEEDEDSSYVLEIAGEEEEDGSLEPASAF4142
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A4216Vc.12647C>T Putative BenignSIFT: tolerated
Polyphen: benign