Paralogue Annotation for RYR2 residue 4256

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4256
Reference Amino Acid: M - Methionine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4256

No paralogue variants have been mapped to residue 4256 for RYR2.



RYR2PEEQGPRMAFFSILTVRSALFALRYNILTL>M<RMLSLKSLKKQMKKVKKMTVKDMVTAFFSS4286
RYR1AEEGAAGLEGTAATAAAGATARVVAAAGRA>L<RGLSYRSLRRRVRRLRRLTAREAATAVAAL4335
RYR3AGEEEEDGSLEPASAFAMACASVKRNVTDF>L<KRATLKNLRKQYRNVKKMTAKELVKVLFSF4187
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M4256Tc.12767T>C Putative BenignSIFT: tolerated
Polyphen: benign