Paralogue Annotation for RYR2 residue 4258

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4258
Reference Amino Acid: M - Methionine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4258

No paralogue variants have been mapped to residue 4258 for RYR2.



RYR2EQGPRMAFFSILTVRSALFALRYNILTLMR>M<LSLKSLKKQMKKVKKMTVKDMVTAFFSSYW4288
RYR1EGAAGLEGTAATAAAGATARVVAAAGRALR>G<LSYRSLRRRVRRLRRLTAREAATAVAALLW4337
RYR3EEEEDGSLEPASAFAMACASVKRNVTDFLK>R<ATLKNLRKQYRNVKKMTAKELVKVLFSFFW4189
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M4258Kc.12773T>A UnknownSIFT:
Polyphen:
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510