Paralogue Annotation for RYR2 residue 4287

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4287
Reference Amino Acid: Y - Tyrosine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4287

No paralogue variants have been mapped to residue 4287 for RYR2.



RYR2RMLSLKSLKKQMKKVKKMTVKDMVTAFFSS>Y<WSIFMTLLHFVASVFRGFFRIICSLLLGGS4317
RYR1RGLSYRSLRRRVRRLRRLTAREAATAVAAL>L<WAAVTRAGAAGAGAAAGALGLLWGSLFGGG4366
RYR3KRATLKNLRKQYRNVKKMTAKELVKVLFSF>F<WMLFVGLFQLLFTILGGIFQILWSTVFGGG4218
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y4287Hc.12859T>C Putative BenignSIFT: tolerated
Polyphen: probably damaging