Paralogue Annotation for RYR2 residue 4333

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4333
Reference Amino Acid: N - Asparagine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4333

No paralogue variants have been mapped to residue 4333 for RYR2.



RYR2RGFFRIICSLLLGGSLVEGAKKIKVAELLA>N<MPDPTQDEVRGDGEEGERKP-LEAALPSED4362
RYR1AGALGLLWGSLFGGGLVEGAKKVTVTELLA>G<MPDPTSDEVHGEQPAGPGGDADGEGASEGA4412
RYR3GGIFQILWSTVFGGGLVEGAKNIRVTKILG>D<MPDPTQFGIHDDTMEAERAEVMEPGITTEL4264
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N4333Dc.12997A>G Putative BenignSIFT: tolerated
Polyphen: benign