Paralogue Annotation for RYR2 residue 448

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 448
Reference Amino Acid: P - Proline
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 448

No paralogue variants have been mapped to residue 448 for RYR2.



RYR2TVFLFNRFIRGLDALSKKAKA----STVDL>P<IESVSLSLQDLIGYFHPPDEHLEHEDKQNR478
RYR1TNGLYNQFIKSLDSFSGKPRGSGPPAGTAL>P<IEGVILSLQDLIIYFEPPSEDLQHEEKQSK466
RYR3TTALFSQFVSGN-----NRTA----APITL>P<IEEVLQTLQDLIAYFQPPEEEMRHEDKQNK465
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P448Ac.1342C>G Putative BenignSIFT: tolerated
Polyphen: benign