Paralogue Annotation for RYR2 residue 4557

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4557
Reference Amino Acid: V - Valine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4557

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1V4629MMyopathy, congenitalHigh8 21911697

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2LPTRSSSENAK-VTSLDS-----SSHRIIA>V<HYVLEESSGYMEPTLRILAILHTVISFFCI4587
RYR1DVSGAGSGGSSGW-GLGAGEEAEGDEDENM>V<YYFLEESTGYMEPALRCLSLLHTLVAFLCI4659
RYR3DVANLWN-------SFND-----EEEEEAM>V<FFVLQESTGYMAPTLRALAIIHTIISLVCV4492
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 4557 for RYR2.