Paralogue Annotation for RYR2 residue 4594

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4594
Reference Amino Acid: K - Lysine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4594

No paralogue variants have been mapped to residue 4594 for RYR2.



RYR2SSGYMEPTLRILAILHTVISFFCIIGYYCL>K<VPLVIFKREKEVARKLEFDGLYITEQPSED4624
RYR1STGYMEPALRCLSLLHTLVAFLCIIGYNCL>K<VPLVIFKREKELARKLEFDGLYITEQPEDD4696
RYR3STGYMAPTLRALAIIHTIISLVCVVGYYCL>K<VPLVVFKREKEIARKLEFDGLYITEQPSED4529
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K4594Rc.13781A>G Other Cardiac PhenotypeSIFT:
Polyphen:
ReportsOther Cardiac Phenotype Ryanodine Receptor Mutations Presenting as Idiopathic Ventricular Fibrillation: A Report on Two Novel Familial Compound Mutations, c.6224T>C and c.13781A>G, With the Clinical Presentation of Idiopathic Ventricular Fibrillation. Pediatr Cardiol. 2014 24950728
p.K4594Qc.13780A>C Inherited ArrhythmiaLQTSSIFT:
Polyphen:
ReportsInherited ArrhythmiaLQTS Exome Analyses of Long QT Syndrome Reveal Candidate Pathogenic Mutations in Calmodulin-Interacting Genes. PLoS One. 2015 10(7):e0130329. doi: 10.1371/journal.pone.0130329. 26132555