Paralogue Annotation for RYR2 residue 4600

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4600
Reference Amino Acid: F - Phenylalanine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4600

No paralogue variants have been mapped to residue 4600 for RYR2.



RYR2PTLRILAILHTVISFFCIIGYYCLKVPLVI>F<KREKEVARKLEFDGLYITEQPSEDDIKGQW4630
RYR1PALRCLSLLHTLVAFLCIIGYNCLKVPLVI>F<KREKELARKLEFDGLYITEQPEDDDVKGQW4702
RYR3PTLRALAIIHTIISLVCVVGYYCLKVPLVV>F<KREKEIARKLEFDGLYITEQPSEDDIKGQW4535
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F4600Lc.13798T>C Inherited ArrhythmiaCPVTSIFT:
Polyphen:
ReportsInherited ArrhythmiaCPVT Gender Differences in the Inheritance Mode of RYR2 Mutations in Catecholaminergic Polymorphic Ventricular Tachycardia Patients. PLoS One. 2015 10(6):e0131517. doi: 10.1371/journal.pone.0131517. 26114861