Paralogue Annotation for RYR2 residue 4625

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4625
Reference Amino Acid: D - Aspartate
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4625

No paralogue variants have been mapped to residue 4625 for RYR2.



RYR2VPLVIFKREKEVARKLEFDGLYITEQPSED>D<IKGQWDRLVINTQSFPNNYWDKFVKRKVMD4655
RYR1VPLVIFKREKELARKLEFDGLYITEQPEDD>D<VKGQWDRLVLNTPSFPSNYWDKFVKRKVLD4727
RYR3VPLVVFKREKEIARKLEFDGLYITEQPSED>D<IKGQWDRLVINTPSFPNNYWDKFVKRKVIN4560
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D4625Ec.13875T>G Putative BenignSIFT: deleterious
Polyphen: possibly damaging