Paralogue Annotation for RYR2 residue 4631

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4631
Reference Amino Acid: D - Aspartate
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4631

No paralogue variants have been mapped to residue 4631 for RYR2.



RYR2KREKEVARKLEFDGLYITEQPSEDDIKGQW>D<RLVINTQSFPNNYWDKFVKRKVMDKYGEFY4661
RYR1KREKELARKLEFDGLYITEQPEDDDVKGQW>D<RLVLNTPSFPSNYWDKFVKRKVLDKHGDIY4733
RYR3KREKEIARKLEFDGLYITEQPSEDDIKGQW>D<RLVINTPSFPNNYWDKFVKRKVINKYGDLY4566
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D4631Vc.13892A>T Inherited ArrhythmiaCPVTSIFT:
Polyphen:
ReportsInherited ArrhythmiaCPVT RYR2 sequencing reveals novel missense mutations in a Kazakh idiopathic ventricular tachycardia study cohort. PLoS One. 2014 9(6):e101059. doi: 10.1371/journal.pone.0101059. e 24978818