Paralogue Annotation for RYR2 residue 4662

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4662
Reference Amino Acid: G - Glycine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4662

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1G4734EMalignant hyperthermiaHigh9 16917943

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2RLVINTQSFPNNYWDKFVKRKVMDKYGEFY>G<RDRISELLGMDKAALDFSDAREKKKPKKDS4692
RYR1RLVLNTPSFPSNYWDKFVKRKVLDKHGDIY>G<RERIAELLGMDLATLEITAHNER-KPNPPP4763
RYR3RLVINTPSFPNNYWDKFVKRKVINKYGDLY>G<AERIAELLGLDKNALDFSPVEET-KA-EAA4595
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G4662Sc.13984G>A Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: possibly damaging
ReportsInherited ArrhythmiaCPVT Catecholaminergic polymorphic ventricular tachycardia: RYR2 mutations, bradycardia, and follow up of the patients. J Med Genet. 2005 42(11):863-70. 16272262
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
p.G4662Vc.13985G>T Putative BenignSIFT: deleterious
Polyphen: probably damaging