Paralogue Annotation for RYR2 residue 4728

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4728
Reference Amino Acid: M - Methionine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4728

No paralogue variants have been mapped to residue 4728 for RYR2.



RYR2LNSIDVKYQMWKLGVVFTDNSFLYLAWYMT>M<SVLGHYNNFFFAAHLLDIAMGFKTLRTILS4758
RYR1LMSIDVKYQIWKFGVIFTDNSFLYLGWYMV>M<SLLGHYNNFFFAAHLLDIAMGVKTLRTILS4829
RYR3LSSIDMKYHIWKLGVVFTDNSFLYLAWYTT>M<SVLGHYNNFFFAAHLLDIAMGFKTLRTILS4661
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M4728Vc.14182A>G Putative BenignSIFT: tolerated
Polyphen: benign