Paralogue Annotation for RYR2 residue 4755

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4755
Reference Amino Acid: T - Threonine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4755

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1T4826IMalignant hyperthermiaHigh9 10888602, 19648156, 20461000, 22131268, 22139840, 12732639

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2YMTMSVLGHYNNFFFAAHLLDIAMGFKTLR>T<ILSSVTHNGKQLVLTVGLLAVVVYLYTVVA4785
RYR1YMVMSLLGHYNNFFFAAHLLDIAMGVKTLR>T<ILSSVTHNGKQLVMTVGLLAVVVYLYTVVA4856
RYR3YTTMSVLGHYNNFFFAAHLLDIAMGFKTLR>T<ILSSVTHNGKQLVLTVGLLAVVVYLYTVVA4688
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 4755 for RYR2.