Paralogue Annotation for RYR2 residue 4860

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4860
Reference Amino Acid: A - Alanine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4860

No paralogue variants have been mapped to residue 4860 for RYR2.



RYR2EIEDPAGDEYEIYRIIFDITFFFFVIVILL>A<IIQGLIIDAFGELRDQQEQVKEDMETKCFI4890
RYR1EIEDPAGDEYELYRVVFDITFFFFVIVILL>A<IIQGLIIDAFGELRDQQEQVKEDMETKCFI4961
RYR3EIEDPAGDPYEMYRIVFDITFFFFVIVILL>A<IIQGLIIDAFGELRDQQEQVREDMETKCFI4793
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A4860Gc.14579C>G Inherited ArrhythmiaCPVTSIFT: tolerated
Polyphen: benign
ReportsInherited ArrhythmiaCPVT Clinical and molecular characterization of patients with catecholaminergic polymorphic ventricular tachycardia. Circulation. 2002 106(1):69-74. 12093772
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
Unknown Loss of luminal Ca2+ activation in the cardiac ryanodine receptor is associated with ventricular fibrillation and sudden death. Proc Natl Acad Sci U S A. 2007 104(46):18309-14. 17984046
Inherited ArrhythmiaCPVT Arrhythmogenesis in a catecholaminergic polymorphic ventricular tachycardia mutation that depresses ryanodine receptor function. Proc Natl Acad Sci U S A. 2015 112(13):E1669-77. doi: 10.1073/pnas.1419795112. 25775566