Paralogue Annotation for RYR2 residue 4949

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4949
Reference Amino Acid: W - Tryptophan
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4949

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1W5020SMalignant hyperthermiaHigh9 24433488
RYR1W5020CMalignant hyperthermiaHigh9 25960145

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2LFFLMYLINKDETEHTGQESYVWKMYQERC>W<EFFPAGDCFRKQYEDQLN4967
RYR1MFFLMYLINKDETEHTGQESYVWKMYQERC>W<DFFPAGDCFRKQYEDQLS5038
RYR3LFFLMYLINKDETEHTGQESYVWKMYQERC>W<DFFPAGDCFRKQYEDQLG4870
cons                              > <                  

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Trp4949Argc.14845T>C UnknownSIFT:
Polyphen: