Paralogue Annotation for RYR2 residue 4950

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4950
Reference Amino Acid: E - Glutamate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4950

No paralogue variants have been mapped to residue 4950 for RYR2.



RYR2FFLMYLINKDETEHTGQESYVWKMYQERCW>E<FFPAGDCFRKQYEDQLN4967
RYR1FFLMYLINKDETEHTGQESYVWKMYQERCW>D<FFPAGDCFRKQYEDQLS5038
RYR3FFLMYLINKDETEHTGQESYVWKMYQERCW>D<FFPAGDCFRKQYEDQLG4870
cons                              > <                 

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E4950Kc.14848G>A Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: benign
ReportsInherited ArrhythmiaCPVT Clinical and molecular characterization of patients with catecholaminergic polymorphic ventricular tachycardia. Circulation. 2002 106(1):69-74. 12093772
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
p.Glu4950Glnc.14848G>C UnknownSIFT:
Polyphen: