Paralogue Annotation for RYR2 residue 658

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 658
Reference Amino Acid: N - Asparagine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 658

No paralogue variants have been mapped to residue 658 for RYR2.



RYR2NQHLICDNLLPGRDLLLQTRLVNHVSSMRP>N<IFLGVSEGSAQYKKWYYELMVDHTEPFVTA688
RYR1NQDLITENLLPGRELLLQTNLINYVTSIRP>N<IFVGRAEGTTQYSKWYFEVMVDEVTPFLTA676
RYR3NQNLICDNLLPRRNLLLQTRLINDVTSIRP>N<IFLGVAEGSAQYKKWYFELIIDQVDPFLTA675
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N658Sc.1973A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging