Paralogue Annotation for RYR2 residue 663

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 663
Reference Amino Acid: V - Valine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 663

No paralogue variants have been mapped to residue 663 for RYR2.



RYR2CDNLLPGRDLLLQTRLVNHVSSMRPNIFLG>V<SEGSAQYKKWYYELMVDHTEPFVTAEATHL693
RYR1TENLLPGRELLLQTNLINYVTSIRPNIFVG>R<AEGTTQYSKWYFEVMVDEVTPFLTAQATHL681
RYR3CDNLLPRRNLLLQTRLINDVTSIRPNIFLG>V<AEGSAQYKKWYFELIIDQVDPFLTAEPTHL680
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V663Ic.1987G>A Putative BenignSIFT: tolerated
Polyphen: benign
p.V663Dc.1988T>A Putative BenignSIFT: tolerated
Polyphen: benign