Paralogue Annotation for RYR2 residue 664

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 664
Reference Amino Acid: S - Serine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 664

No paralogue variants have been mapped to residue 664 for RYR2.



RYR2DNLLPGRDLLLQTRLVNHVSSMRPNIFLGV>S<EGSAQYKKWYYELMVDHTEPFVTAEATHLR694
RYR1ENLLPGRELLLQTNLINYVTSIRPNIFVGR>A<EGTTQYSKWYFEVMVDEVTPFLTAQATHLR682
RYR3DNLLPRRNLLLQTRLINDVTSIRPNIFLGV>A<EGSAQYKKWYFELIIDQVDPFLTAEPTHLR681
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S664Tc.1991G>C Putative BenignSIFT: tolerated
Polyphen: benign