Paralogue Annotation for RYR2 residue 708

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 708
Reference Amino Acid: G - Glycine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 708

No paralogue variants have been mapped to residue 708 for RYR2.



RYR2MVDHTEPFVTAEATHLRVGWASTEGYSPYP>G<GGEEWGGNGVGDDLFSYGFDGLHLWSGCIA738
RYR1MVDEVTPFLTAQATHLRVGWALTEGYTPYP>G<AGEGWGGNGVGDDLYSYGFDGLHLWTGHVA726
RYR3IIDQVDPFLTAEPTHLRVGWASSSGYAPYP>G<GGEGWGGNGVGDDLYSYGFDGLHLWSGRIP725
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G708Ac.2123G>C Putative BenignSIFT: tolerated
Polyphen: possibly damaging