Paralogue Annotation for RYR2 residue 77

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 77
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 77

No paralogue variants have been mapped to residue 77 for RYR2.



RYR2CFLESTSNSKNVPPDLSICTFVLEQSLSVR>A<LQEMLANTVEKSEGQVDVEKWKFMMKTAQG107
RYR1CFLEPTSNAQNVPPDLAICCFVLEQSLSVR>A<LQEMLANTVEAG--V---E-------SSQG94
RYR3CFLEPTSEAKYIPPDLCVCNFVLEQSLSVR>A<LQEMLANTGENG-GE---G-------AAQG97
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A77Vc.230C>T CardiomyopathyARVD/CSIFT: tolerated
Polyphen: benign
ReportsCardiomyopathyARVD/C Juvenile sudden death in a family with polymorphic ventricular arrhythmias caused by a novel RyR2 gene mutation: evidence of specific morphological substrates. Hum Pathol. 2005 36(7):761-7. 16084945
CardiomyopathyARVD/C Crystal structures of the N-terminal domains of cardiac and skeletal muscle ryanodine receptors: insights into disease mutations. Structure. 2009 17(11):1505-14. 19913485
CardiomyopathyARVD/C Abnormal termination of Ca2+ release is a common defect of RyR2 mutations associated with cardiomyopathies. Circ Res. 2012 110(7):968-77. 22374134
CardiomyopathyARVD/C New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405