Paralogue Annotation for RYR2 residue 832

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 832
Reference Amino Acid: L - Leucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 832

No paralogue variants have been mapped to residue 832 for RYR2.



RYR2FLLGGRHGEFKFLPPPGYAPCYEAVLPKEK>L<KVEHSREYKQERTYTRDLLGPTVSLTQAAF862
RYR1FLLGGRHGEFKFLPPPGYAPCHEAVLPRER>L<HLEPIKEYRREGPRGPHLVGPSRCLSHTDF850
RYR3FLMGGRHGEFKFLPPSGYAPCYEALLPKEK>M<RLEPVKEYKRDADGIRDLLGTTQFLSQASF849
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L832Wc.2495T>G Putative BenignSIFT: deleterious
Polyphen: probably damaging