Paralogue Annotation for RYR2 residue 837

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 837
Reference Amino Acid: S - Serine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 837

No paralogue variants have been mapped to residue 837 for RYR2.



RYR2RHGEFKFLPPPGYAPCYEAVLPKEKLKVEH>S<REYKQERTYTRDLLGPTVSLTQAAFTPIPV867
RYR1RHGEFKFLPPPGYAPCHEAVLPRERLHLEP>I<KEYRREGPRGPHLVGPSRCLSHTDFVPCPV855
RYR3RHGEFKFLPPSGYAPCYEALLPKEKMRLEP>V<KEYKRDADGIRDLLGTTQFLSQASFIPCPV854
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S837Tc.2510G>C Putative BenignSIFT: deleterious
Polyphen: benign