Paralogue Annotation for RYR2 residue 863

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 863
Reference Amino Acid: T - Threonine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 863

No paralogue variants have been mapped to residue 863 for RYR2.



RYR2KVEHSREYKQERTYTRDLLGPTVSLTQAAF>T<PIPVDTSQIVLPPHLERIREKLAENIHELW893
RYR1HLEPIKEYRREGPRGPHLVGPSRCLSHTDF>V<PCPVDTVQIVLPPHLERIREKLAENIHELW881
RYR3RLEPVKEYKRDADGIRDLLGTTQFLSQASF>I<PCPVDTSQVILPPHLEKIRDRLAENIHELW880
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T863Ac.2587A>G UnknownSIFT:
Polyphen: possibly damaging