Paralogue Annotation for RYR2 residue 867

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 867
Reference Amino Acid: V - Valine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 867

No paralogue variants have been mapped to residue 867 for RYR2.



RYR2SREYKQERTYTRDLLGPTVSLTQAAFTPIP>V<DTSQIVLPPHLERIREKLAENIHELWVMNK897
RYR1IKEYRREGPRGPHLVGPSRCLSHTDFVPCP>V<DTVQIVLPPHLERIREKLAENIHELWALTR885
RYR3VKEYKRDADGIRDLLGTTQFLSQASFIPCP>V<DTSQVILPPHLEKIRDRLAENIHELWGMNK884
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V867Mc.2599G>A Putative BenignSIFT:
Polyphen: probably damaging