Paralogue Annotation for RYR2 residue 877

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 877
Reference Amino Acid: H - Histidine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 877

No paralogue variants have been mapped to residue 877 for RYR2.



RYR2TRDLLGPTVSLTQAAFTPIPVDTSQIVLPP>H<LERIREKLAENIHELWVMNKIELGWQYGPV907
RYR1GPHLVGPSRCLSHTDFVPCPVDTVQIVLPP>H<LERIREKLAENIHELWALTRIEQGWTYGPV895
RYR3IRDLLGTTQFLSQASFIPCPVDTSQVILPP>H<LEKIRDRLAENIHELWGMNKIELGWTFGKI894
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H877Yc.2629C>T Putative BenignSIFT: tolerated
Polyphen: possibly damaging
p.H877Pc.2630A>C Putative BenignSIFT: deleterious
Polyphen: probably damaging